General Information

  • ID:  hor002106
  • Uniprot ID:  P51462
  • Protein name:  Insulin-like growth factor I
  • Gene name:  IGF1
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0010648 negative regulation of cell communication; GO:0023057 negative regulation of signaling; GO:0043066 negative regulation of apoptotic process; GO:0048856 anatomical structure development; GO:0050896 response to stimulus; GO:0090201 negative regulation of release of cytochrome c from mitochondria
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSA
  • Length:  70
  • Propeptide:  IHFFYLGLCLLTLTSSAAAGPETLCGAELVDALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSARSVRAQRHTDMPKAQKEVHLKNTSRGNTGNRNYRM
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. Binds to integrins.
  • Mechanism:  Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-48; 18-61; 47-52
  • Structure ID:  AF-P51462-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002106_AF2.pdbhor002106_ESM.pdb

Physical Information

Mass: 897481 Formula: C338H525N95O100S7
Absent amino acids: NW Common amino acids: GCLS
pI: 7.78 Basic residues: 11
Polar residues: 24 Hydrophobic residues: 19
Hydrophobicity: -29.57 Boman Index: -11803
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 62.71
Instability Index: 6173.86 Extinction Coefficient cystines: 4845
Absorbance 280nm: 70.22

Literature

  • PubMed ID:  NA
  • Title:  NA